Indian or Common Cobra (Naja naja naja): ...with the patient. This antivenom contains the appropriate fractions necessary to neutralize the components of Indian Cobra venom. ...
http://www-surgery.ucsd.edu/ent/DAVIDSON/Snake/3cnames.htm

Listing by Common Names: Ringhals Anchita's cobra Egyptian or brown cobra Forest or black cobra Taiwan or Chinese cobra Monocellate cobra Indian cobra or Cobra de Capello Central Asian ...
http://animaldiversity.ummz.umich.edu/site/accounts/information/Naja_naja.html

ADW: Naja naja: Information: Naja naja. Naja naja (Indian cobra). ... ragged bands. The Indian cobra may grow from 1.8m to 2.2m. (India4U,2000; Discovery, 2000; Breen, 1974). ...
http://animaldiversity.ummz.umich.edu/site/accounts/classification/Naja_naja.html

ADW: Naja naja: Classification: Naja naja (Indian cobra). Information; Classification. ... Parent taxa. pictures. Genus Naja (cobras). information. Species Naja naja (Indian cobra). ...
http://astral.berkeley.edu/asteroids-1.65/sequences/sf/a.133.1.fa

d1poa__ a.133.1.2 (-) Snake phospholipase A2 {Taiwan cobra (Naja ...: ...wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapyndndyninlkarc >d1a3d__ a.133.1.2 (-) Snake phospholipase A2 {Indian cobra (Naja naja naja ...
http://astral.berkeley.edu/asteroids-1.65/alignments/fam/a.133.1.2.fasta_aln

d1poa__ a.133.1.2 (-) Snake phospholipase A2 {Taiwan cobra (Naja ...: EAEKISGC-----WPYFKTYSYECSQGTLTCKGGNNACAAAVCDCDRLAAICFAGA--PY NDNDYNINLKARC----- d1a3d__ a.133.1.2 (-) Snake phospholipase A2 {Indian cobra (Naja naja naja ...
http://opbs.okstate.edu/~Blair/Bioch4113/1999%20Student%20Presentations/Liston%20folder/tsld013.htm

Indian Cobra: Indian Cobra. Polypeptide chain of 119 amino acids, and MW of 13,346. Phospholipase function and catalytic activity similar to Diamondback. ...
http://opbs.okstate.edu/~Blair/Bioch4113/1999%20Student%20Presentations/Liston%20folder/tsld014.htm

Indian Cobra: Indian Cobra. Histidine: Red (47): Aspartate: Blue (93). ...
http://www.vet.uga.edu/ivcvm/2000/Velman/Velman.htm

ENDO-PARASITIC SURVEY IN CAPTIVE COBRAS (Naja naja)* [Abstract]: Acknowledgement: Copyrighted photograph of Indian Cobra (Naja naja) by Dr. Wolfgang Wuster, School of Biological Sciences, University of Wales, Bangor LL57 2UW ...
http://www.vet.uga.edu/vpp/ia/Students/bs/

India | Brian Stacy | Class of 2001: ...these potentially dangerous animals. In western zoos, visitors may observe an Indian cobra or a Saltwater crocodile. A few of these ...
http://ntri.tamuk.edu/homepage-ntri/perez-home/toxicity.html

Relative Toxicity in Snake Venoms: The order of toxicity is based upon the cobra scale, which has a number of one, and the other snake venoms are compared to the Indian cobra (Naja naja naja). ...
http://ntri.tamuk.edu/herpetarium/viperidae/m.euryxanthus/meuryxanthus.htm

Western Coral Snake: Snake). The brightly banded Western Coral Snake, a relative of the Indian Cobra, injects a venom twice as powerful as the rattlesnake. ...
http://hubcap.clemson.edu/~jservey/TimeLords/altbst5.txt

Copyright crap: The author of this thingy retains full copyright ...: They are often multicolored greens and browns with a rich, distinctive patterning The threat posture of the Indian Cobra is to hold the front third of its body ...
http://www.iit.edu/~bhatmeh1/mammals.html

Gir-Census Data: 20. Buff Stripped Keelback, Amphiesma syelata. 21. Common Indian Krait, Buungarus caeruleus. 22. Indian Cobra, Naja naja. 23. Russel Viper, Vopera russelli. 24. ...
http://www.psc.edu/general/software/seq/seqsort/maxsegs.out

Program PSC MAXSEGS started on April 20,1998 14:34:28 psrsaw vs ...: A2 (EC 3.1.1.4) - western diamondback ratt Library Sequence: 1PSHC, with length: 119 (1PSHC) phospholipase A2 (EC 3.1.1.4), chain C - Indian cobra [ 11: 71 ...
http://iacuc.ufl.edu/OLD%20Web%20Site/infectiousdis.htm

Reptile Infectious Diseases: ...gland herpesvirus - Padgett and Levine, in attempting to elucidate the substructure of murine Rauscher leukemia virus with venoms of the Indian cobra (Naja naja ...
http://biology.unm.edu/biology/coccidia/snakes.html

Coccidia of the World: Eimeria najae Ray and Das Gupta, 1936: Host: Naja naja (Indian cobra); Reference: Ray and Das Gupta 1936. ... from the intestine of an Indian cobra, Naja naja. ...
http://biology.unm.edu/biology/coccidia/caryospo.html

Coccidia of the World: Nandi, R. Caryospora cobrae n. sp. from the Indian cobra Naja naja Linnaeus. Journal of Protozoology 32: 204-205. Paperna, I. 1991. ...
http://www.uic.edu/classes/phar/phar402/Nicotinic%20Agents%20and%20Anticholinesterases3.htm

PHAR 402: ...of the electric organs of the electric eel and the specific antagonist, a-bungarotoxin (see its peptide structure on handout # 20) of the Indian cobra or the ...
http://stevens.scripps.edu/ESGDB/EC_3.html

PDB id code: 1PSH, CA, ..... phospholipase a=2= (ec.3.1.1.4) (phosphatidylcholine 2-acylhydrolase), .... indian cobra (naja naja naja). 1CEH, CA, ..... ...
http://aeroweb.brooklyn.cuny.edu/specs/bell/ah-1f.htm

Aircraft: Bell AH-1F Cobra: Pakistan Army is using Cobras Ah-1F since 1985,with an awsome safety record ... They are giving support to the infantry divisions stationed along the Indian border ...
http://aeroweb.brooklyn.cuny.edu/specs/sikorsky/uh-60a.htm

Aircraft: Sikorsky UH-60A Black Hawk: Hawk, (two words) from the UTTAS contract, regardless of who it was named after, which brings to bear the question: Where is the AH-1 "Cobra" Indian tribe from ...
http://adsabs.harvard.edu/abs/1993PNAS...90..342F

Crystal Structure of Phospholipase A_2 from Indian Cobra Reveals a ...: Article (HTML) · · Translate Abstract Title: Crystal Structure of Phospholipase A_2 from Indian Cobra Reveals a Trimeric Association Authors: Fremont, Daved H ...
http://lfd.uiuc.edu/staff/hazlett/hazlettcv.html

Theodore L. Hazlett: Hazlett, TL and EA Dennis. (1985) Affinity Chromatography of Phospholipase A 2 from Naja naja naja (Indian Cobra) Venom. Toxicon 23, 457-466. ...
http://www.sscnet.ucla.edu/southasia/Religions/Avatars/Natar.html

Manas: Indian Religions, Nataraja: The image of Shiva as Nataraj is indelibly stitched into the Indian imagination ... lower left hand points down to the demon Muyalaka, who is shown holding a cobra. ...
http://www.csusm.edu/indianrock/fieldtrips/pendelton/camp_pendleton.html

Indian Rock Native Garden: Camp Pendleton: Deborah Small: Fieldtrips Indian Rock Spring 2003 Hidden Meadows Fall 2003 The Glens Fall ... An occasional Cobra helicopter flew directly overhead, and we could hear machine gun ...
http://convex.hhmi.columbia.edu/hendw/fremont/papers.html

fremont papers: H. (1993). Crystal Structure of Phospholipase A2 from Indian Cobra Reveals a Trimeric Association. Proc. Natl. Acad. Sci. USA 90 ...
http://faculty.ist.unomaha.edu/pdasgupta/allmovies/movies_c.htm

The Indian Hindi movies starting with Letter “C�?: The Indian Hindi movies starting with Letter "C": CID (1956) Keyword Matches: 6; Size: 1 ... COBRA (1980) Keyword Matches: 6; Size: 0 kb; Last Updated: 23 Oct 1999; ...
http://www.bio.ilstu.edu/julianolab/mary/India.htm

Back to Home Trip to South India (Tamil Nadu), June 2003: Naja naja. Albino common cobra. king cobra. Sampath from the Irula tribe. rat snake. rat which met an unforunate fate.... Indian rock python eating a rat. scorpion ...
http://www.uni.edu/gai/India/India_Lesson_Plans/Comparing_Folktales.htm

Comparing_Folk_Tales: Students will be similarities and difference between Indian and American folktales. ... Illustrate the new Indian vocabulary words that were in the story. ...
http://www.lpl.arizona.edu/~mhutchis/oz/oz.htm

The Land Down Under: Aust) 6) WA Tiger Snake(Aust) 7) Chappell Isl Tiger Snake(Aust) 8) Death Adder (Aust) 9) Western Brown (Aust) 10) Copperhead(Aust) 11) Indian Cobra(India) 12 ...
http://itech.pjc.edu/jkaplan/zootech/Course%20Materials/herplec23.htm

Snakes – Part 3: Amazonian Coral Snake. Banded Egyptian Cobra. Black-necked Cobra. Indian Spectacled Cobra. King Cobra. King Cobra female. Mamba. Tiger Snake. Taipan. Death Adder ...
http://chaos.swmed.edu/etblast/user/user-1015735726/lforem.html

Results of the search: Soto MA ... Toha J Orig Life 1983 Dec;13(2):147-52. The N-terminal amino acid sequences of two basic cytotoxic proteins from the venom of the Indian Cobra. ...
http://nationalzoo.si.edu/Animals/ReptilesAmphibians/Meet_the_zoos_herps/default.cfm?id=53

King cobra - National Zoo| FONZ: King cobra, Taxonomy: Class, Reptilia. Order: Squamata. Family: Elapidae. Genus and species: Ophiophagus hannah. Learn about another reptile or amphibian: ...
http://nationalzoo.si.edu/Animals/ReptilesAmphibians/Meet_the_zoos_herps/default.cfm?id=47

False water cobra - National Zoo| FONZ: Range and habitat of the False water cobra. Brought to you by the National Zoo| FONZ.
http://www.genetics.wustl.edu/fish_lab/frank/cgi-bin/fish/list.cgi?p=fk51

WUZGR - EST Project Home: 373 1.4e-33 1, 101077 (1), -, -, -. fk51c09.x1, pir||S06674 cytotoxin homolog - Indian cobra >pdb|1CVO| ... 43 0.97 2, 101076 (1), -, -, -. ...
http://www.ccsd.edu/weblessons/third%20grade/tropical.htm

Tropical Rainforest Animals: Bearded Pig Blue Birds of Paradise. Brazilian Tapir. Chimpanzee. Flying Dragon Gorilla. Indian Cobra. Okapi. Orangutan. Salano. Slow Loris. Vine Snake. Xenosaurus ...
http://www.personal.utulsa.edu/~marc-carlson/game/tlpoison.txt

Copyright crap: The author of this thingy retains full copyright ...: Indian Cobra Venom Administration N Dose: .05 g Effect: 10 min (-1 All) 5 min/24 hours, (+1 All) 1 day/infinity Treatment: Appropriate Antivenin Note: It is ...
http://www.asel.udel.edu/~ramanath/view_kar.html

Dr.Anderson's Indian diary: ...is important to know the appropriate name: noone will know where the Indian Institute of ... snake charmer wandering up and down the street with his pet cobra in a ...
http://chronicle.uchicago.edu/040715/ramanujan.shtml

Doniger shares insights on Ramanujan’s poetry, teachings: After serving as a Visiting Professor at Chicago, the distinguished Indian playwright Girish Karnad wrote Play with a Cobra. The ...
http://quizbowl.stanford.edu/archive/technophobia5/oxytoss.txt

Packet Submitted for Occidental Quiz Bowl by Wesley Mathews ...: ...variety of genus ~Oxyuranus~ delivers enough miolysin and neurotoxins in one attack to kill 60 humans, a venom 50 times as toxic as the common Indian cobra. ...
http://notes.utk.edu/bio/greenberg.nsf/0/2d98e6a290cd241885256b0a00753ea7?OpenDocument

1971 Greenberg - serpent: Millions of Hindus continue to revere the sacred phallic Lingam of Shiva and its symbol on Earth, the Indian cobra (Naja naja). ...
http://www.calstatela.edu/univ/ppa/newsrel/afables.bak

Panchatantra: She adds, "You'll see crows, owls, doves, monkeys, crocodiles, jackals, bulls, an Indian lion king and the fascinating cobra, all dancing to intricate Indian ...
http://www.csuohio.edu/india_experience/summer2001/in_india/july2001/20010727/20010727.htm

Indian Cobra Indian_Cobra Indian Cobra Indian_Cobra Indian Cobra -->